Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HERC6 antibody - N-terminal region (ARP43237_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP43237_P050-FITC Conjugated

ARP43237_P050-HRP Conjugated

ARP43237_P050-Biotin Conjugated

Gene Symbol:
HERC6
NCBI Gene Id:
55008
Official Gene Full Name:
HECT and RLD domain containing E3 ubiquitin protein ligase family member 6
Protein Name:
Probable E3 ubiquitin-protein ligase HERC6
Swissprot Id:
Q8IVU3
Protein Accession #:
NP_060382
Nucleotide Accession #:
NM_017912
Alias Symbols:
FLJ20637
Replacement Item:
This antibody may replace item sc-88939 from Santa Cruz Biotechnology.
Description of Target:
HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).
Protein Size (# AA):
1022
Molecular Weight:
115kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HERC6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HERC6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HERC6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-HERC6 (ARP43237_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; UBC; HSP90AA1; UBQLN2; HERC4; HERC3; NME2;
Blocking Peptide:
For anti-HERC6 (ARP43237_P050) antibody is Catalog # AAP43237 (Previous Catalog # AAPP11312)
Datasheets/Manuals:
Printable datasheet for anti-HERC6 (ARP43237_P050) antibody
Sample Type Confirmation:

HERC6 is supported by BioGPS gene expression data to be expressed in HEK293

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...