Aviva Systems Biology office will be closed for Labor Day - September 3rd, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

HCLS1 antibody - N-terminal region (ARP31928_T100)

100 ul
In Stock

Conjugation Options

ARP31928_T100-FITC Conjugated

ARP31928_T100-HRP Conjugated

ARP31928_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Hematopoietic cell-specific Lyn substrate 1
Protein Name:
Hematopoietic lineage cell-specific protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1536 from Santa Cruz Biotechnology.
Description of Target:
HCLS1 Tyr phosphorylation catalyzed by Syk and Lyn plays a crucial role in the translocation of the protein to the membrane and is involved in the cytoskeleton rearrangement triggered by thrombin in human platelets. This gene is a substrate for caspase cleavage during apoptosis.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HCLS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HCLS1.
The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-HCLS1 (ARP31928_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HCLS1 (ARP31928_T100) antibody is Catalog # AAP31928
Printable datasheet for anti-HCLS1 (ARP31928_T100) antibody
Sample Type Confirmation:

HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Ruzzene,M., et al., (2002) Biochem. J. 364 (Pt 1), 41-47

Tell us what you think about this item!

Write A Review
    Please, wait...