Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GTPBP3 Antibody - middle region (ARP96867_P050)

100 ul
$289.00
In Stock
Gene Symbol:
GTPBP3
NCBI Gene Id:
84705
Official Gene Full Name:
MSS1, MTGP1, THDF1, GTPBG3, COXPD23
Protein Name:
This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described.
Swissprot Id:
Q969Y2-3
Protein Accession #:
NP_001122327.1
Nucleotide Accession #:
NM_001128855.2
Alias Symbols:
tRNA modification GTPase GTPBP3, mitochondrial
Description of Target:
This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
471
Molecular Weight:
51 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GTPBP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GTPBP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GTPBP3
Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GTPBP3 (ARP96867_P050) antibody is Catalog # AAP96867
Datasheets/Manuals:
Printable datasheet for anti-GTPBP3 (ARP96867_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...