Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GRIA2 antibody - N-terminal region (AVARP13060_T100)

100 ul
$229.00
In Stock

Conjugation Options

AVARP13060_T100-FITC Conjugated

AVARP13060_T100-HRP Conjugated

AVARP13060_T100-Biotin Conjugated

Gene Symbol:
GRIA2
NCBI Gene Id:
2891
Official Gene Full Name:
Glutamate receptor, ionotropic, AMPA 2
Protein Name:
Glutamate receptor 2
Swissprot Id:
P42262
Protein Accession #:
NP_000817
Nucleotide Accession #:
NM_000826
Alias Symbols:
GLUR2, GLURB, GluA2, HBGR2, GluR-K2
Replacement Item:
This antibody may replace item sc-158551, HPA008441
Description of Target:
Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of GLU are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.
Protein Size (# AA):
883
Molecular Weight:
99kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GRIA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GRIA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-GRIA2 (AVARP13060_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Pick1; GTF3C2; Grip1; RAB11A; MYO5A; GRIA1; REST; GRIP2; SDCBP; NSF; SQSTM1; GRIA3; SPTAN1; PRKCA; DRD2; SPTBN1; GRIK2; CACNG2; GRIK5; GRID2; DLG4;
Blocking Peptide:
For anti-GRIA2 (AVARP13060_T100) antibody is Catalog # AAP30702 (Previous Catalog # AAPP01359)
Datasheets/Manuals:
Printable datasheet for anti-GRIA2 (AVARP13060_T100) antibody
Target Reference:
Sun, W., et al., (1994) NeuroReport 5:441-444.

Tell us what you think about this item!

Write A Review
    Please, wait...