Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GRIA2 antibody - N-terminal region (AVARP13038_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP13038_T100-FITC Conjugated

AVARP13038_T100-HRP Conjugated

AVARP13038_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Glutamate receptor, ionotropic, AMPA 2
Protein Name:
Glutamate receptor 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-158551, HPA008441
Description of Target:
GRIA2 is one of the glutamate receptors, which are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with mul
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GRIA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GRIA2.
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-GRIA2 (AVARP13038_T100)
Peptide Sequence:
Synthetic peptide located within the following region: STSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTIT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GRIA2 (AVARP13038_T100) antibody is Catalog # AAP30703 (Previous Catalog # AAPP01360)
Printable datasheet for anti-GRIA2 (AVARP13038_T100) antibody
Target Reference:
Gryder,D.S., et al., (2005) J. Neurochem. 94 (6), 1728-1738

Tell us what you think about this item!

Write A Review
    Please, wait...