Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GPSM2 antibody - N-terminal region (ARP51303_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP51303_P050-FITC Conjugated

ARP51303_P050-HRP Conjugated

ARP51303_P050-Biotin Conjugated

Gene Symbol:
GPSM2
NCBI Gene Id:
29899
Official Gene Full Name:
G-protein signaling modulator 2
Protein Name:
G-protein-signaling modulator 2
Swissprot Id:
P81274
Protein Accession #:
NP_037428
Nucleotide Accession #:
NM_013296
Alias Symbols:
LGN, Pins, PINS, DFNB82
Replacement Item:
This antibody may replace item sc-106999, HPA007327
Description of Target:
Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]).[supplied by OMIM].
Protein Size (# AA):
677
Molecular Weight:
76kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPSM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPSM2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GPSM2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-GPSM2 (ARP51303_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; GLIS2; SUMO1; INSC; GPSM2; HRAS; NUMA1; GNAI3; GNAI2; GNAO1; GNAI1;
Blocking Peptide:
For anti-GPSM2 (ARP51303_P050) antibody is Catalog # AAP51303 (Previous Catalog # AAPS23704)
Datasheets/Manuals:
Printable datasheet for anti-GPSM2 (ARP51303_P050) antibody
Additional Information:
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Izaki,T., (2006) Biochem. Biophys. Res. Commun. 341 (4), 1001-1006

Tell us what you think about this item!

Write A Review
    Please, wait...