Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GNB4 antibody - middle region (ARP57549_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP57549_P050-FITC Conjugated

ARP57549_P050-HRP Conjugated

ARP57549_P050-Biotin Conjugated

Gene Symbol:
GNB4
NCBI Gene Id:
59345
Official Gene Full Name:
Guanine nucleotide binding protein (G protein), beta polypeptide 4
Protein Name:
Guanine nucleotide-binding protein subunit beta-4
Swissprot Id:
Q9HAV0
Protein Accession #:
NP_067642
Nucleotide Accession #:
NM_021629
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-110843 from Santa Cruz Biotechnology.
Description of Target:
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.
Protein Size (# AA):
340
Molecular Weight:
37kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GNB4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GNB4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GNB4
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-GNB4 (ARP57549_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO2; GNG8; GNG12; GNG2; GNG13; GNGT1; GNG11; GNG10; GNG7; GNG5; GNG4; GNG3; FBXO6; CDK18; ADRB2; PAN2; MTNR1A; ESR1; GNAI3; GNAI2; GNAI1; PDCL; CEP97; RGS6; Haus1; Haus4; Mau2; Trim69; Cdk1; MTNR1B; GNGT2; git11;
Blocking Peptide:
For anti-GNB4 (ARP57549_P050) antibody is Catalog # AAP57549 (Previous Catalog # AAPP43035)
Datasheets/Manuals:
Printable datasheet for anti-GNB4 (ARP57549_P050) antibody
Specificity:
Gene Symbol:GNB1,GNB2,GNB3
Protein Accession#:NP_002065,NP_005264,NP_002066
Nucleotide Accession#:NM_002074,NM_005273,NM_002075
Swissprot ID:P62873,P62879,P16520
Subunit:
beta1-4

Tell us what you think about this item!

Write A Review
    Please, wait...