Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Glutathione S-transferase Recombinant Protein (German Cocktroach) (OPCA04188)

* Required Fields

$0.00
In Stock
Gene Symbol:
Glutathione S-transferase
Alias Symbols:
GST class-sigma Major allergen Bla g 5 Allergen: Bla g 5
Description of Target:
RX + glutathione = HX + R-S-glutathione.
Swissprot Id:
O18598
Protein Name:
Glutathione S-transferase
Molecular Weight:
39 kDa
Product Format:
Liquid
Species Reactivity:
German Cocktroach
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length: APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Additional Information:
Species Specificity Detail: Blattella germanica (German cockroach) (Blatta germanica)
Tag:
N-terminal 6xHis-SUMO-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
Induction of IgE antibody responses by glutathione S-transferase from the German cockroach (Blattella germanica).Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Hayden M.L., Chapman M.D.J. Biol. Chem. 272:20907-20912(1997)
Datasheets/Manuals:
Printable datasheet for OPCA04188
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...