Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GLUD1 antibody - N-terminal region (ARP45708_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP45708_P050-FITC Conjugated

ARP45708_P050-HRP Conjugated

ARP45708_P050-Biotin Conjugated

Gene Symbol:
GLUD1
NCBI Gene Id:
2746
Official Gene Full Name:
Glutamate dehydrogenase 1
Protein Name:
Glutamate dehydrogenase 1, mitochondrial
Swissprot Id:
P00367
Protein Accession #:
NP_005262
Nucleotide Accession #:
NM_005271
Alias Symbols:
GDH, GDH1, GLUD, MGC132003
Replacement Item:
This antibody may replace item sc-115824 from Santa Cruz Biotechnology.
Description of Target:
L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification. L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084
Protein Size (# AA):
558
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GLUD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GLUD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 86%; Yeast: 86%; Zebrafish: 83%
Complete computational species homology data:
Anti-GLUD1 (ARP45708_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; UBC; DCP2; KLHL29; SUMO1; NEDD8; LSM1; ILK; CDK5; VTN; SEC62; STAT5A; ORM1; HPX; NR4A1; FN1; CRP; ASGR2; CUL3; ELAVL1; EBNA-LP; HDAC5; ICT1; GLUD1; DYNLL1; GOT2;
Blocking Peptide:
For anti-GLUD1 (ARP45708_P050) antibody is Catalog # AAP45708 (Previous Catalog # AAPP11841)
Datasheets/Manuals:
Printable datasheet for anti-GLUD1 (ARP45708_P050) antibody
Sample Type Confirmation:

GLUD1 is strongly supported by BioGPS gene expression data to be expressed in HT1080

Additional Information:
IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Kawajiri,M., (2006) Pediatr. Res. 59 (3), 359-364
Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

203/07/2018 23:00
  • Quality:
  • Overall Experience:
Brain homgenates in WB

Submitted by:

Dr. Jennifer McGuire
Research Instructor
University of Cincinnati

GLUD1

"worked pretty well in both rat and pig brain tissue, we may need to increase amount of tissue or antibody”


1. Sample Type/Lane Description:
Lane 1: 7.5 ug rat hippocampus homogenate
Lane 2: 7.5 ug rat cortex homogenate
Lane 3: 7.5 ug pig cortex homogenate

2. Primary Antibody Dilution: 1:1000

3. Secondary Antibody and Dilution: LiCor infrared secondaries 1:5000; anti-mouse 800 (green) and anti-rabbit 680 (red).

4. Sample Preparation Method: Samples were denatured at 70C for 15 minutes and we use a denaturing sample buffer.

5. Protocol:
Samples were denatured at 70C for 15 minutes and we use a denaturing sample buffer.
The protein was run on 4-15% Tris-glycine gels at 200V for 35 minutes and transferred on a semi-dry transfer system 20V for 20 minutes (PVDF membrane). The membranes were washed in TBS-T and blocked 1h RT with agitation in LiCor Odyssey blocking buffer, the buffer for the primaries is Odyssey + .2% Tween.
The primary concentration was 1:1000 for Aviva’s GLUD1 antibody, and 1:1000 of VCP (mouse monoclonal).
The blots were incubated O/N at 4C, washed, incubated in LiCor infrared secondaries 1:5000; anti-mouse 800 (green) and anti-rabbit 680 (red). Blots were visualized on a LiCor system.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...