Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GJD2 antibody - middle region (ARP36623_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP36623_P050-FITC Conjugated

ARP36623_P050-HRP Conjugated

ARP36623_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Gap junction protein, delta 2, 36kDa
Protein Name:
Gap junction delta-2 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CX36, GJA9, MGC138315, MGC138319
Replacement Item:
This antibody may replace item sc-14904 from Santa Cruz Biotechnology.
Description of Target:
GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.This gene is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GJD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GJD2.
The immunogen is a synthetic peptide directed towards the middle region of human GJD2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-GJD2 (ARP36623_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GJD2 (ARP36623_P050) antibody is Catalog # AAP36623 (Previous Catalog # AAPP07862)
Printable datasheet for anti-GJD2 (ARP36623_P050) antibody
Sample Type Confirmation:

GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Charpantier,E., (2007) Diabetologia 50 (11), 2332-2341

Tell us what you think about this item!

Write A Review
    Please, wait...