Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GJA1 antibody - middle region (ARP36597_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP36597_P050-FITC Conjugated

ARP36597_P050-HRP Conjugated

ARP36597_P050-Biotin Conjugated

Gene Symbol:
GJA1
NCBI Gene Id:
2697
Official Gene Full Name:
Gap junction protein, alpha 1, 43kDa
Protein Name:
Gap junction alpha-1 protein
Swissprot Id:
P17302
Protein Accession #:
NP_000156
Nucleotide Accession #:
NM_000165
Alias Symbols:
CX43, DFNB38, GJAL, ODDD, HSS, AVSD3, HLHS1
Replacement Item:
This antibody may replace item sc-119391 from Santa Cruz Biotechnology.
Description of Target:
Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. Connexin 43 is targeted by several protein kinases that regulate myocardial cell-cell coupling. A related intron-less connexin 43 pseudogene, GJA1P, has been mapped to chromosome 5. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
382
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GJA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GJA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GJA1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-GJA1 (ARP36597_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; STAMBP; EPS15; UBQLN4; PSMD4; PSMD2; S100A1; GJA1; CNST; NEDD4; TJP1; HGS; TSG101; SGSM3; GJA5; MAPK7; MAPK3; CAV1; CSNK1D; SRC; PRKCG; PRKCE; PRKCB; PRKCA; MAPK1; NOV; CSK; GJA3;
Blocking Peptide:
For anti-GJA1 (ARP36597_P050) antibody is Catalog # AAP36597 (Previous Catalog # AAPP07836)
Datasheets/Manuals:
Printable datasheet for anti-GJA1 (ARP36597_P050) antibody
Target Reference:
Feller,L., (2008) Am. J. Med. Genet. A 146A (10), 1350-1353

Tell us what you think about this item!

Write A Review
    Please, wait...