Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GABRA5 antibody - middle region (ARP34984_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP34984_P050-FITC Conjugated

ARP34984_P050-HRP Conjugated

ARP34984_P050-Biotin Conjugated

Gene Symbol:
GABRA5
NCBI Gene Id:
2558
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, alpha 5
Protein Name:
Gamma-aminobutyric acid receptor subunit alpha-5
Swissprot Id:
P31644
Protein Accession #:
NP_000801
Nucleotide Accession #:
NM_000810
Alias Symbols:
MGC138184
Replacement Item:
This antibody may replace item sc-111120 from Santa Cruz Biotechnology.
Description of Target:
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Transcript variants utilizing three different alternative non-coding first exons have been described.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Transcript variants utilizing three different alternative non-coding first exons have been described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
462
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRA5.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GABRA5
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-GABRA5 (ARP34984_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-GABRA5 (ARP34984_P050) antibody is Catalog # AAP34984 (Previous Catalog # AAPP06211)
Datasheets/Manuals:
Printable datasheet for anti-GABRA5 (ARP34984_P050) antibody
Subunit:
alpha-5
Target Reference:
Netzer,C., (2008) Am. J. Med. Genet. B Neuropsychiatr. Genet. 147 (1), 37-41

Tell us what you think about this item!

Write A Review
    Please, wait...