Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GABRA3 antibody - N-terminal region (AVARP13027_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

AVARP13027_T100-FITC Conjugated

AVARP13027_T100-HRP Conjugated

AVARP13027_T100-Biotin Conjugated

Gene Symbol:
GABRA3
NCBI Gene Id:
2556
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, alpha 3
Protein Name:
Gamma-aminobutyric acid receptor subunit alpha-3
Swissprot Id:
P34903
Protein Accession #:
NP_000799
Nucleotide Accession #:
NM_000808
Replacement Item:
This antibody may replace item sc-133603, HPA000839
Description of Target:
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel.
Protein Size (# AA):
492
Molecular Weight:
55kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRA3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRA3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GABRA3 (AVARP13027_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SDCBP2; UGT2B7; UBQLN1;
Blocking Peptide:
For anti-GABRA3 (AVARP13027_T100) antibody is Catalog # AAP30685 (Previous Catalog # AAPP01342)
Datasheets/Manuals:
Printable datasheet for anti-GABRA3 (AVARP13027_T100) antibody
Subunit:
alpha-3
Target Reference:
Hadingham, K.L., et al., (1993) Mol. Pharmacol. 43:970-975.

Tell us what you think about this item!

Write A Review
    Please, wait...