Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GABRA3 antibody - middle region (ARP34981_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP34981_T100-FITC Conjugated

ARP34981_T100-HRP Conjugated

ARP34981_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, alpha 3
Protein Name:
Gamma-aminobutyric acid receptor subunit alpha-3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Replacement Item:
This antibody may replace item sc-133603, HPA000839
Description of Target:
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRA3.
The immunogen is a synthetic peptide directed towards the middle region of human GABRA3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GABRA3 (ARP34981_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GABRA3 (ARP34981_T100) antibody is Catalog # AAP34981 (Previous Catalog # AAPP06208)
Printable datasheet for anti-GABRA3 (ARP34981_T100) antibody
Target Reference:
Chou,K.C. et al., (2004) Biochem. Biophys. Res. Commun. 316 (3), 636-642

Tell us what you think about this item!

Write A Review
    Please, wait...