Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Foxf1a antibody - middle region (ARP37048_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP37048_P050-FITC Conjugated

ARP37048_P050-HRP Conjugated

ARP37048_P050-Biotin Conjugated

Gene Symbol:
Foxf1
NCBI Gene Id:
15227
Official Gene Full Name:
Forkhead box F1a
Protein Name:
Forkhead box protein F1
Swissprot Id:
Q61080
Protein Accession #:
NP_034556
Nucleotide Accession #:
NM_010426
Alias Symbols:
AI450827, FREAC1, Foxf1, Freac-1, HFH-8, Hfh8, Foxf1a
Replacement Item:
This antibody may replace item sc-133589 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
353
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Foxf1a.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Foxf1a.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse Foxf1a
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-Foxf1a (ARP37048_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Foxf1 (ARP37048_P050) antibody is Catalog # AAP37048 (Previous Catalog # AAPP09244)
Datasheets/Manuals:
Printable datasheet for anti-Foxf1 (ARP37048_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...