Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FBXO25 antibody - N-terminal region (ARP43117_P050)

100 ul
In Stock

Conjugation Options

ARP43117_P050-FITC Conjugated

ARP43117_P050-HRP Conjugated

ARP43117_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
F-box protein 25
Protein Name:
F-box only protein 25
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FBX25, MGC20256, MGC51975
Replacement Item:
This antibody may replace item sc-100735 from Santa Cruz Biotechnology.
Description of Target:
FBXO25 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbxs class. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXO25.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXO25.
The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO25
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 93%
Complete computational species homology data:
Anti-FBXO25 (ARP43117_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FBXO25 (ARP43117_P050) antibody is Catalog # AAP43117 (Previous Catalog # AAPP25086)
Printable datasheet for anti-FBXO25 (ARP43117_P050) antibody
Target Reference:
Hagens,O., (2006) Biochim. Biophys. Acta 1760 (1), 110-118

Tell us what you think about this item!

Write A Review
    Please, wait...