Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FBXO15 antibody - N-terminal region (ARP53103_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP53103_P050-FITC Conjugated

ARP53103_P050-HRP Conjugated

ARP53103_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
F-box protein 15
Protein Name:
F-box only protein 15
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FBX15, MGC39671
Replacement Item:
This antibody may replace item sc-84823 from Santa Cruz Biotechnology.
Description of Target:
FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXO15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXO15.
The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO15
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-FBXO15 (ARP53103_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FBXO15 (ARP53103_P050) antibody is Catalog # AAP53103 (Previous Catalog # AAPP36947)
Printable datasheet for anti-FBXO15 (ARP53103_P050) antibody
Target Reference:
Jin,J., (2004) Genes Dev. 18 (21), 2573-2580
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...