Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FAH antibody - N-terminal region (ARP41680_P050)

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP41680_P050-FITC Conjugated

ARP41680_P050-HRP Conjugated

ARP41680_P050-Biotin Conjugated

Gene Symbol:
FAH
NCBI Gene Id:
2184
Official Gene Full Name:
Fumarylacetoacetate hydrolase (fumarylacetoacetase)
Protein Name:
Fumarylacetoacetase
Swissprot Id:
P16930
Protein Accession #:
NP_000128
Nucleotide Accession #:
NM_000137
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-62356 from Santa Cruz Biotechnology.
Description of Target:
FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia. This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
419
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FAH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FAH.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FAH
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%
Complete computational species homology data:
Anti-FAH (ARP41680_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR;
Blocking Peptide:
For anti-FAH (ARP41680_P050) antibody is Catalog # AAP41680 (Previous Catalog # AAPP12505)
Datasheets/Manuals:
Printable datasheet for anti-FAH (ARP41680_P050) antibody
Additional Information:
IHC Information: Kidney
IHC Information: Liver
Target Reference:
Liu,J., (er) Hum Brain Mapp (2007) In press
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...