Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ESR2 antibody - N-terminal region (ARP35863_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP35863_P050-FITC Conjugated

ARP35863_P050-HRP Conjugated

ARP35863_P050-Biotin Conjugated

Gene Symbol:
ESR2
NCBI Gene Id:
2100
Official Gene Full Name:
Estrogen receptor 2 (ER beta)
Protein Name:
Estrogen receptor beta
Swissprot Id:
Q92731
Protein Accession #:
NP_001428
Nucleotide Accession #:
NM_001437
Alias Symbols:
ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2
Replacement Item:
This antibody may replace item sc-35325 from Santa Cruz Biotechnology.
Description of Target:
ESR2 is a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. It contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.
Protein Size (# AA):
530
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ESR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ESR2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ESR2
Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 91%
Complete computational species homology data:
Anti-ESR2 (ARP35863_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PLSCR1; MEOX2; NOTCH2NL; RFX6; MMS19; BCAS2; NCOA1; RPS18; MRPS15; MRPS22; ZC3HAV1; PTCD3; EXOSC4; MRPS2; MED4; MRPS27; MRPS31; MED17; TRIM24; NRIP1; NCOA3; STAU1; SP1; PABPC5; MYLK2; RPS11; RPS4X; RPLP0; RPL36AL; PPP5C; HSPA8; ESR2; ESR1; ACTB; SRA1; ARI
Blocking Peptide:
For anti-ESR2 (ARP35863_P050) antibody is Catalog # AAP35863 (Previous Catalog # AAPP06995)
Datasheets/Manuals:
Printable datasheet for anti-ESR2 (ARP35863_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...