Aviva Systems Biology office will be closed for Thanksgiving Holiday - November 22-23, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EIF5A Antibody - C-terminal region : FITC (ARP73950_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP73950_P050 Unconjugated

ARP73950_P050-HRP Conjugated

ARP73950_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
EIF5A
NCBI Gene Id:
1984
Official Gene Full Name:
eukaryotic translation initiation factor 5A
Protein Name:
eukaryotic translation initiation factor 5A-1
Swissprot Id:
P63241-2
Alias Symbols:
EIF-5A, EIF5A1, eIF5AI
Protein Size (# AA):
184
Molecular Weight:
20kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF5A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF5A.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IF5A1
Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
HUWE1; UBC; REL; MEOX2; DHPS; CRX; DCP2; STUB1; BCCIP; WDR1; GDA; TYMS; PEPD; MVD; HSPD1; GNS; GLS; UBD; NPM1; IQCB1; ATF2; VCP; MACF1; DDX17; VAPA; XPO1; ATP5B; XPO4; CUL2; COPS5; TCF3; ELAVL1; SUMO2; VHL; Pds5a; Csnk1e; DOHH; XRN2; RPL5; TGM2;
Blocking Peptide:
For anti-EIF5A (ARP73950_P050-FITC) antibody is Catalog # AAP73950
Datasheets/Manuals:
Printable datasheet for anti-EIF5A (ARP73950_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Tell us what you think about this item!

Write A Review
    Please, wait...