Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EIF3E antibody - N-terminal region (ARP48175_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP48175_P050-FITC Conjugated

ARP48175_P050-HRP Conjugated

ARP48175_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Eukaryotic translation initiation factor 3, subunit E
Protein Name:
Eukaryotic translation initiation factor 3 subunit E
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
EIF3-P48, EIF3S6, INT6, eIF3-p46
Replacement Item:
This antibody may replace item sc-176131 from Santa Cruz Biotechnology.
Description of Target:
EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF3E.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF3E.
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3E
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-EIF3E (ARP48175_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EIF3E (ARP48175_P050) antibody is Catalog # AAP48175 (Previous Catalog # AAPP28684)
Printable datasheet for anti-EIF3E (ARP48175_P050) antibody
Sample Type Confirmation:

EIF3E is supported by BioGPS gene expression data to be expressed in HEK293T

Additional Information:
IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Buchsbaum,S., (2007) Oncogene 26 (35), 5132-5144

Tell us what you think about this item!

Write A Review
    Please, wait...