Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP48176_P050-FITC Conjugated

ARP48176_P050-HRP Conjugated

ARP48176_P050-Biotin Conjugated

Gene Symbol:
EIF3E
NCBI Gene Id:
3646
Official Gene Full Name:
Eukaryotic translation initiation factor 3, subunit E
Protein Name:
Eukaryotic translation initiation factor 3 subunit E
Swissprot Id:
P60228
Protein Accession #:
NP_001559
Nucleotide Accession #:
NM_001568
Alias Symbols:
EIF3-P48, EIF3S6, INT6, eIF3-p46
Replacement Item:
This antibody may replace item sc-176131 from Santa Cruz Biotechnology.
Description of Target:
EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
Protein Size (# AA):
445
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF3E.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF3E.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EIF3E
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-EIF3E (ARP48176_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; C4orf19; RUNDC3A; HUWE1; TRIM63; TRIM55; STAU1; SUMO1; NEDD8; GPRASP2; LARP1; GNB2L1; RPS28; RPS25; RPS23; RPS20; RPS19; RPS18; RPS12; RPS10; RPS9; RPS8; RPS3A; RPS3; RPS2; EIF3CL; DYNC1LI1; FBXO6; EIF3D; IGSF8; NPM1; ICAM1; CD81; EIF3B; VCAM1; POLR2
Blocking Peptide:
For anti-EIF3E (ARP48176_P050) antibody is Catalog # AAP48176 (Previous Catalog # AAPP28685)
Datasheets/Manuals:
Printable datasheet for anti-EIF3E (ARP48176_P050) antibody
Subunit:
E
Target Reference:
Buchsbaum,S., (2007) Oncogene 26 (35), 5132-5144
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...