Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EFNA2 antibody - middle region : FITC (ARP61345_P050-FITC)

100 ul
$289.00
In Stock

Conjugation Options

ARP61345_P050 Unconjugated

ARP61345_P050-HRP Conjugated

ARP61345_P050-Biotin Conjugated

Gene Symbol:
EFNA2
NCBI Gene Id:
1943
Official Gene Full Name:
Ephrin-A2
Protein Name:
Ephrin-A2
Swissprot Id:
O43921
Protein Accession #:
NP_001396
Nucleotide Accession #:
NM_001405
Alias Symbols:
ELF-1, EPLG6, HEK7-L, LERK6, LERK-6
Replacement Item:
This antibody may replace item sc-33163 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
Protein Size (# AA):
213
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EFNA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EFNA2.
Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-EFNA2 (ARP61345_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
BAP1; ADAM10; EPHA5; EPHA3; EPHA2; RUNX1; EPHA7; ZHX1;
Blocking Peptide:
For anti-EFNA2 (ARP61345_P050-FITC) antibody is Catalog # AAP61345 (Previous Catalog # AAPP48210)
Datasheets/Manuals:
Printable datasheet for anti-EFNA2 (ARP61345_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Tell us what you think about this item!

Write A Review
    Please, wait...