Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EED antibody - N-terminal region (ARP35697_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP35697_P050-FITC Conjugated

ARP35697_P050-HRP Conjugated

ARP35697_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Embryonic ectoderm development
Protein Name:
Polycomb protein EED
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133537 from Santa Cruz Biotechnology.
Description of Target:
EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EED.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EED.
The immunogen is a synthetic peptide directed towards the N terminal region of human EED
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-EED (ARP35697_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EED (ARP35697_P050) antibody is Catalog # AAP35697 (Previous Catalog # AAPP06943)
Printable datasheet for anti-EED (ARP35697_P050) antibody
Sample Type Confirmation:

EED is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference:
Rakotobe,D., (er) Virol. J. 5, 32 (2008)

Lin, PC; Huang, HD; Chang, CC; Chang, YS; Yen, JC; Lee, CC; Chang, WH; Liu, TC; Chang, JG; Long noncoding RNA TUG1 is downregulated in non-small cell lung cancer and can regulate CELF1 on binding to PRC2. 16, 583 (2016). IF, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27485439

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

43/02/2018 00:13
  • Overall Experience:
  • Quality:
Immunoflorescence with Rat Brain

- Sergio Ojeda
Senior Scientist and Head 
Division of Neuroscience
Oregon National Primate Research Center

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...