Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EDF1 antibody - middle region (ARP38383_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP38383_P050-FITC Conjugated

ARP38383_P050-HRP Conjugated

ARP38383_P050-Biotin Conjugated

Gene Symbol:
EDF1
NCBI Gene Id:
8721
Official Gene Full Name:
Endothelial differentiation-related factor 1
Protein Name:
Endothelial differentiation-related factor 1
Swissprot Id:
O60869
Protein Accession #:
NP_003783
Nucleotide Accession #:
NM_003792
Alias Symbols:
EDF-1, MBF1, MGC9058
Replacement Item:
This antibody may replace item sc-133536 from Santa Cruz Biotechnology.
Description of Target:
EDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene.
Protein Size (# AA):
148
Molecular Weight:
16kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EDF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EDF1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EDF1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Complete computational species homology data:
Anti-EDF1 (ARP38383_P050)
Peptide Sequence:
Synthetic peptide located within the following region: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MEOX2; UBC; IDH3G; UBE2I; MAPK6; NRL; JUN; CEBPA; NR1H3; NR5A2; PPARG; TBP; TAF1; NR5A1; RXRA; PRKCA; ATF2; CREB1; ATF1; CALM3; CALM1;
Blocking Peptide:
For anti-EDF1 (ARP38383_P050) antibody is Catalog # AAP38383 (Previous Catalog # AAPP20569)
Datasheets/Manuals:
Printable datasheet for anti-EDF1 (ARP38383_P050) antibody
Target Reference:
Bolognese,F., Gene 374, 87-95 (2006)

Tell us what you think about this item!

Write A Review
    Please, wait...