Aviva Systems Biology office will be closed for Independence Day - July 4th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DULLARD antibody - middle region (ARP47144_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP47144_P050-FITC Conjugated

ARP47144_P050-HRP Conjugated

ARP47144_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CTDNEP1
NCBI Gene Id:
23399
Official Gene Full Name:
CTD nuclear envelope phosphatase 1
Protein Name:
CTD nuclear envelope phosphatase 1
Swissprot Id:
O95476
Protein Accession #:
NP_056158
Nucleotide Accession #:
NM_015343
Alias Symbols:
HSA011916, NET56, DULLARD
Description of Target:
DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.
Protein Size (# AA):
244
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DULLARD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DULLARD.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DULLARD
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-DULLARD (ARP47144_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CNEP1R1; UBC;
Blocking Peptide:
For anti-CTDNEP1 (ARP47144_P050) antibody is Catalog # AAP47144 (Previous Catalog # AAPP27919)
Datasheets/Manuals:
Printable datasheet for anti-CTDNEP1 (ARP47144_P050) antibody
Target Reference:
Kim,Y., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (16), 6596-6601
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...