Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DGKE antibody - N-terminal region (ARP45494_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP45494_P050-FITC Conjugated

ARP45494_P050-HRP Conjugated

ARP45494_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
DGKE
NCBI Gene Id:
8526
Official Gene Full Name:
Diacylglycerol kinase, epsilon 64kDa
Protein Name:
Diacylglycerol kinase epsilon
Swissprot Id:
P52429
Protein Accession #:
NP_003638
Nucleotide Accession #:
NM_003647
Alias Symbols:
DAGK6, DGK, DAGK5
Description of Target:
Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.
Protein Size (# AA):
567
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DGKE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DGKE.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DGKE
Species Reactivity:
Human, Rabbit
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rabbit: 77%
Complete computational species homology data:
Anti-DGKE (ARP45494_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MRPL44; ARRB2; ARRB1; NUF2; NUDC; PAICS; SET; PDHA1;
Blocking Peptide:
For anti-DGKE (ARP45494_P050) antibody is Catalog # AAP45494 (Previous Catalog # AAPP26559)
Datasheets/Manuals:
Printable datasheet for anti-DGKE (ARP45494_P050) antibody
Target Reference:
Epand,R.M., (2007) Biochemistry 46 (49), 14225-14231

Tell us what you think about this item!

Write A Review
    Please, wait...