Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CYP1A1 antibody - middle region (ARP41404_P050)

Scroll Horizontally to view all Images

 

Print Page
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP41404_P050-FITC Conjugated

ARP41404_P050-HRP Conjugated

ARP41404_P050-Biotin Conjugated

Gene Symbol:
CYP1A1
NCBI Gene Id:
1543
Official Gene Full Name:
Cytochrome P450, family 1, subfamily A, polypeptide 1
Protein Name:
Cytochrome P450 1A1
Swissprot Id:
P04798
Protein Accession #:
NP_000490
Nucleotide Accession #:
NM_000499
Alias Symbols:
AHH, AHRR, CP11, CYP1, P1-450, P450-C, P450DX
Replacement Item:
This antibody may replace item sc-101828 from Santa Cruz Biotechnology.
Description of Target:
CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
512
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP1A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP1A1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-CYP1A1 (ARP41404_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CMTM5; CYB5A;
Blocking Peptide:
For anti-CYP1A1 (ARP41404_P050) antibody is Catalog # AAP41404 (Previous Catalog # AAPP24142)
Datasheets/Manuals:
Printable datasheet for anti-CYP1A1 (ARP41404_P050) antibody
Target Reference:
Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487

Customer Reviews for CYP1A1 Antibody (ARP41404_P050) tested with human kidney tissue in Immunohistochemistry

CAT# ARP41404

submitted by:
Atif Ahmed
Children's Mercy Hospital and Clinic
Kansas City, MO
USA

How do Aviva's reagents play a role in your experimental goals?

Immunohistochemical identification of cytochrome p450 isoforms is of paramount importance in detecting chemoresistant cancer cells. Cyp1A1 is a major isoform that has been detected in numerous human cancer cells

How many different experimental trials were conducted using the antibody sample?

Three different IHC trials were conducted.

What type of experimental sample are you using and how did you prepare it?

Human kidney.

What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.

1:100 dilution of primary antibody. Experiment performed on compact polymer HRP system using Bond polymer Refine detection System (Leica Microsystems).

What controls were used in your experiment? Please include your positive control.

Fetal Kidney, known to be positive

For IHC, what antigen retrieval method did you use?

i) No pretreatment, ii) ER1 (20) ph 6.0; iii) ER2 (20) ph 9.0

How did you store the antibody after re-suspension?

-20 degrees centigrade

How would you rate this antibody on a scale from 1-5? Why?

5. Clean results; precise location of staining

Would you use this antibody in future experiments?

Yes

Have you used another antibody which has worked in your application?

NA

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes; good results that are based on prior scientific findings

Product Protocols: CYP1A1 antibody tested with Human Hela Cells (ARP41404_P050)

Aviva Systems Biology is the original manufacturer of this CYP1A1 antibody (ARP41404_P050)

Click here to view the CYP1A1 antibody Western Blot Protocol

Product Datasheet Link: CYP1A1 antibody (ARP41404_P050)

WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela

Western Blot image:


Description of Target: CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CYP1A1 antibody (ARP41404_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...