Aviva Systems Biology office will be closed for Thanksgiving - November 23rd, 2017 and November 24th, 2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CYBB Antibody - C-terminal region (ARP70865_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
$289.00
In Stock

Conjugation Options

ARP70865_P050-FITC Conjugated

ARP70865_P050-HRP Conjugated

ARP70865_P050-Biotin Conjugated

Gene Symbol:
CYBB
NCBI Gene Id:
1536
Swissprot Id:
P04839
Protein Accession #:
NP_000388
Nucleotide Accession #:
NM_000397
Alias Symbols:
AMCBX2, CGD, GP91-1, GP91-PHOX, GP91PHOX, NOX2, p91-PHOX
Replacement Item:
This antibody may replace item sc-130543 from Santa Cruz Biotechnology.
Description of Target:
Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
Protein Size (# AA):
570
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYBB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYBB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYBB
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 93%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide Sequence:
Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
IQGAP1; ACTB; UBC; SUMO1; RAC1; NCF4; NCF2; NCF1; CYBA; ACTG1;
Blocking Peptide:
For anti-CYBB (ARP70865_P050) antibody is Catalog # AAP70865
Datasheets / Downloads:
Printable datasheet for anti-CYBB (ARP70865_P050) antibody
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...