Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CTNNB1 antibody - N-terminal region (P100600_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

P100600_T100-FITC Conjugated

P100600_T100-HRP Conjugated

P100600_T100-Biotin Conjugated

Gene Symbol:
CTNNB1
NCBI Gene Id:
1499
Official Gene Full Name:
Catenin (cadherin-associated protein), beta 1, 88kDa
Protein Name:
Catenin beta-1
Swissprot Id:
P35222
Protein Accession #:
NP_001895
Nucleotide Accession #:
NM_001904
Alias Symbols:
CTNNB
Replacement Item:
This antibody may replace item sc-116622 from Santa Cruz Biotechnology.
Description of Target:
CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.
Protein Size (# AA):
781
Molecular Weight:
85kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTNNB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTNNB1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CTNNB1
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 83%
Complete computational species homology data:
Anti-CTNNB1 (P100600_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PPARD; PLA2G4A; FBXO45; BTRC; SUMO1; UBC; HUWE1; CDH5; CDH2; TCF4; TBL1X; SOX1; SKP1; RNF220; CACYBP; FBXW11; SUMO2; SIAH1; Apc2; COPS5; RNF14; CDH1; SP1; KCTD1; MDM2; UBE2B; GSK3B; NEK2; RBX1; PTGS2; STRN3; LATS2; APC; ELAVL1; AMOT; ABL1; AXIN1; CBL; LEF
Blocking Peptide:
For anti-CTNNB1 (P100600_T100) antibody is Catalog # AAP30903 (Previous Catalog # AAPP01627)
Datasheets/Manuals:
Printable datasheet for anti-CTNNB1 (P100600_T100) antibody
Sample Type Confirmation:

CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Target Reference:
Strausberg, R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903.

Tell us what you think about this item!

Write A Review
    Please, wait...