Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CSTB antibody - N-terminal region (ARP59177_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP59177_P050-FITC Conjugated

ARP59177_P050-HRP Conjugated

ARP59177_P050-Biotin Conjugated

Gene Symbol:
CSTB
NCBI Gene Id:
1476
Official Gene Full Name:
Cystatin B (stefin B)
Protein Name:
Cystatin-B
Swissprot Id:
P04080
Protein Accession #:
NP_000091
Nucleotide Accession #:
NM_000100
Alias Symbols:
CST6, EPM1, PME, STFB, ULD, EPM1A
Replacement Item:
This antibody may replace item sc-101510 from Santa Cruz Biotechnology.
Description of Target:
CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy.
Protein Size (# AA):
98
Molecular Weight:
11kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CSTB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CSTB.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CSTB
Species Reactivity:
Cow, Horse, Human, Pig, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Horse: 93%; Human: 100%; Pig: 92%; Rat: 75%; Sheep: 100%
Complete computational species homology data:
Anti-CSTB (ARP59177_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SARNP; DPP7; BAG3; CFTR; ECT2; SEC24A; NUDC; MAT2A; FLNB; DCUN1D1; CUL3; RAD21; SPRY2; CTSL; CTSD; CTSH; CTSB; CST3; VHL;
Blocking Peptide:
For anti-CSTB (ARP59177_P050) antibody is Catalog # AAP59177 (Previous Catalog # AAPP45145)
Datasheets/Manuals:
Printable datasheet for anti-CSTB (ARP59177_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...