Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CREB1 antibody - middle region (ARP39811_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP39811_P050-FITC Conjugated

ARP39811_P050-HRP Conjugated

ARP39811_P050-Biotin Conjugated

Gene Symbol:
CREB1
NCBI Gene Id:
1385
Official Gene Full Name:
CAMP responsive element binding protein 1
Protein Name:
Cyclic AMP-responsive element-binding protein 1
Swissprot Id:
P16220
Protein Accession #:
NP_604391
Nucleotide Accession #:
NM_134442
Alias Symbols:
CREB, MGC9284
Replacement Item:
This antibody may replace item sc-186 from Santa Cruz Biotechnology.
Description of Target:
CREB1 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms.
Protein Size (# AA):
341
Molecular Weight:
37kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CREB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CREB1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CREB1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CREB1 (ARP39811_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; NCOR1; CREM; CREBBP; RPS6KA1; NR5A2; EP300; DEAF1; TP53; CREB1; PRKG1; YAP1; MAPK14; MEIS1; DAXX; TSSK4; AKT1; ATR; SIRT1; SRA1; DR1; ATF7; GSK3B; GSK3A; ATXN3; DNMT3B; RPS6KA5; YY1; RGS13; JUN; HDAC2; HDAC1; CCDC6; PPP1CA; SUMO1; TAF4; POU2F1; MYOD1
Blocking Peptide:
For anti-CREB1 (ARP39811_P050) antibody is Catalog # AAP39811 (Previous Catalog # AAPP21825)
Datasheets/Manuals:
Printable datasheet for anti-CREB1 (ARP39811_P050) antibody
Sample Type Confirmation:

CREB1 is strongly supported by BioGPS gene expression data to be expressed in HT1080

There is BioGPS gene expression data showing that CREB1 is expressed in HEK293

Target Reference:
Mamdani,F., Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (4), 500-504

Tell us what you think about this item!

Write A Review
    Please, wait...