Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CPLX2 antibody - N-terminal region (ARP52225_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP52225_P050-FITC Conjugated

ARP52225_P050-HRP Conjugated

ARP52225_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CPLX2
NCBI Gene Id:
10814
Official Gene Full Name:
Complexin 2
Protein Name:
Complexin-2
Swissprot Id:
Q6PUV4
Protein Accession #:
NP_006641
Nucleotide Accession #:
NM_006650
Alias Symbols:
921-L, CPX-2, CPX2, Hfb1, MGC138492
Description of Target:
Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
134
Molecular Weight:
15
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CPLX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CPLX2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CPLX2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CPLX2 (ARP52225_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
APP; STX3; STX2; STX1A;
Blocking Peptide:
For anti-CPLX2 (ARP52225_P050) antibody is Catalog # AAP52225 (Previous Catalog # AAPP42435)
Datasheets/Manuals:
Printable datasheet for anti-CPLX2 (ARP52225_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...