Now Offering Over 102,157 Antibodies & 44,722 Antigens!

COMT antibody - middle region (ARP44327_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP44327_P050-FITC Conjugated

ARP44327_P050-HRP Conjugated

ARP44327_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Catechol O-methyltransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-128345 from Santa Cruz Biotechnology.
Description of Target:
Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathwa
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COMT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COMT.
The immunogen is a synthetic peptide directed towards the middle region of human COMT
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 79%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-COMT (ARP44327_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-COMT (ARP44327_P050) antibody is Catalog # AAP44327 (Previous Catalog # AAPS14511)
Printable datasheet for anti-COMT (ARP44327_P050) antibody
Target Reference:
Shiels,M.S., (2008) Prev Med 47 (1), 116-122

Tell us what you think about this item!

Write A Review
    Please, wait...