Aviva Systems Biology office will be closed for Thanksgiving Holiday - November 22-23, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

COBLL1 antibody - N-terminal region : FITC (ARP42423_P050-FITC)

100 ul
$319.00
In Stock

Conjugation Options

ARP42423_P050 Unconjugated

ARP42423_P050-HRP Conjugated

ARP42423_P050-Biotin Conjugated

Gene Symbol:
COBLL1
NCBI Gene Id:
22837
Official Gene Full Name:
COBL-like 1
Protein Name:
Cordon-bleu protein-like 1
Swissprot Id:
A6NMZ3
Protein Accession #:
NP_055715
Nucleotide Accession #:
NM_014900
Alias Symbols:
KIAA0977, COBLR1
Replacement Item:
This antibody may replace item sc-132238 from Santa Cruz Biotechnology.
Description of Target:
The function remains known.
Protein Size (# AA):
1166
Molecular Weight:
128kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COBLL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COBLL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human COBLL1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-COBLL1 (ARP42423_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
NRD1; PACSIN1;
Blocking Peptide:
For anti-COBLL1 (ARP42423_P050-FITC) antibody is Catalog # AAP42423 (Previous Catalog # AAPP11560)
Datasheets/Manuals:
Printable datasheet for anti-COBLL1 (ARP42423_P050-FITC) antibody
Sample Type Confirmation:

COBLL1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Additional Information:
IHC Information: HepG2 cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 8%.
Target Reference:
Carroll,E.A., (2003) Dev. Biol. 262 (1), 16-31

Tell us what you think about this item!

Write A Review
    Please, wait...