Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CNBP antibody - N-terminal region (ARP34815_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP34815_P050-FITC Conjugated

ARP34815_P050-HRP Conjugated

ARP34815_P050-Biotin Conjugated

Gene Symbol:
CNBP
NCBI Gene Id:
7555
Official Gene Full Name:
CCHC-type zinc finger, nucleic acid binding protein
Protein Name:
Cellular nucleic acid-binding protein
Swissprot Id:
P62633
Protein Accession #:
NP_003409
Nucleotide Accession #:
NM_003418
Alias Symbols:
CNBP1, DM2, PROMM, RNF163, ZCCHC22, ZNF9
Replacement Item:
This antibody may replace item sc-51052 from Santa Cruz Biotechnology.
Description of Target:
CNBP is a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene.This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
177
Molecular Weight:
19kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CNBP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CNBP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CNBP
Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CNBP (ARP34815_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; EZH2; BMI1; SUZ12; RNF2; BZW2; FERMT2; PFAS; EIF6; HSPA9; DFFA; MAPK14; PAN2; VCAM1; ITGA4; KCND3; Mis12; Cnbp; ZWINT; MYH4; FKTN; PCBP2; RPL31; HNRNPA3; BRIX1; APOBEC3C; RBMX; RSL1D1; RPL36; HNRNPUL1; EBNA1BP2; IGF2BP3; IGF2BP1; SYNCRIP; HNRNPR; DAP
Blocking Peptide:
For anti-CNBP (ARP34815_P050) antibody is Catalog # AAP34815 (Previous Catalog # AAPP06023)
Datasheets/Manuals:
Printable datasheet for anti-CNBP (ARP34815_P050) antibody
Target Reference:
Gerbasi,V.R. (2007) Mol. Cell Proteomics 6 (6), 1049-1058

Tell us what you think about this item!

Write A Review
    Please, wait...