Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CLU antibody - C-terminal region (ARP61142_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP61142_P050-FITC Conjugated

ARP61142_P050-HRP Conjugated

ARP61142_P050-Biotin Conjugated

Gene Symbol:
CLU
NCBI Gene Id:
1191
Official Gene Full Name:
Clusterin
Protein Name:
Clusterin
Swissprot Id:
P10909
Protein Accession #:
NP_001822
Nucleotide Accession #:
NM_001831
Alias Symbols:
AAG4, APOJ, CLI, KUB1, MGC24903, SGP-2, SGP2, SP-40, APO-J, NA1/NA2
Replacement Item:
This antibody may replace item sc-113920, HPA000572
Description of Target:
The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Protein Size (# AA):
501
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CLU.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CLU.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CLU
Species Reactivity:
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 91%; Rat: 86%
Complete computational species homology data:
Anti-CLU (ARP61142_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HYOU1; HSP90B1; HSPA5; BAX; TUFM; NUCB2; HSPA1L; TUBB6; MDM2; FOS; CDK19; APOA1; KEAP1; POLR1C; RPL23; KLF11; BAG6; RBBP8; MAPK9; PDIA3; CYP2E1; BCL2L1; TSC22D4; MDC1; LIG4; PAXIP1; CLUAP1; IL24; PRNP; PON1; HSPD1; APP; FBXO6; LYZ; LRP2; HBA1; XRCC6; ELN;
Blocking Peptide:
For anti-CLU (ARP61142_P050) antibody is Catalog # AAP61142 (Previous Catalog # AAPP47252)
Datasheets/Manuals:
Printable datasheet for anti-CLU (ARP61142_P050) antibody
Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: CLU antibody - C-terminal region (ARP61142_P050) in Human HK2 cell (kidney proximal tubular cell line) using Western Blot
Product Page for CLU antibody - C-terminal region (ARP61142_P050)

Researcher: The University of Queensland, School of Medicine, Centre for Kidney Disease Research
Application: Western blotting
Species + Tissue/Cell type: Human HK2 cell (kidney proximal tubular cell line)
How many ug's of tissue/cell lysate run on the gel:
1. 40 ug human HK2 cell (kidney proximal tubular cell line) lysate
2. 40 ug H2O2 treated human HK2 Cell lysate
3. 40 ug H2O2 treated human HK2 Cell lysate
4. 40 ug H2O2 treated human HK2 Cell lysate
5. 40 ug H2O2 treated human HK2 Cell lysate
6. 40 ug H2O2 treated human HK2 Cell lysate
Primary antibody dilution: 1:1000
Secondary antibody: Goat anti-Rabbit HRP
Secondary antibody dilution: 1:2000



Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Determine their expression levels in response to oxidative stress.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4 - A strong band were detected at approximately the 58kDa range, although a much strong band was also detected at a higher MW. Nevertheless, they both seem to have identical response to the treatments.
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva's website is correct? Yes, althoug a bit vague.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, little has been studied on the changes of CLU in kidney disease pakients, of which oxidative stress a role in the pathogenesis.
How did you store the antibody after re-suspension? Aliquoted for single use at -20 degree Celsius.
Sample Description, Species, Tissue/Cell Type: Human. HK2 cell (kidney proximal tubular cell line). 40 ug
How many different experimental trials were conducted using the antibody sample? 1
What type of experimental sample are you using and how did you preparing it? HK2 cells were grown in 10cm cell culture dishes in Dulbecco's modified Eagle's Medium: Ham's F-12 (DMEM/F12) containing antibiotics Penicillin (1000 U/ml) and Streptomycin (1000 ug/ml), and fetal bovine serum (FBS) and allowed 24h to adehere. Cells were exposed to hydrogen peroxide (H2O2) diluted in growth media at 0.2, 0.4, 0.6. 0.8, 1.0 mM for 2h.
Primary used and dilution: 1:1000; overnight (approx 18h) at 4 degree celsius.
Secondary used and dilution: Goat anti-rabbit IgG Horseradish peroxidate conjugate(G21234) (Molecular Probes-Invitrogen), 1:2000, 1h at RT.
What controls were used in your experiment? Please include your positive control: Untreated cells.
Experimental Procedure/Protocols: Cells were placed on ice and washed X3 with cold phosphate buffered saline (PBS), then scraped into radio-immunoprecipitation assay (RIPA) cell lysis buffer (0.15 M sodium chloride, 0.025 M sodium fluoride, 0.5 M ethylenediaminetetraacetic acid), 0.1% sodium dodecylsulphate (SDS), 1.0% lgepal in 50 mM Tris-Cl, pH 7.5) containing phosphatase and protease inhibitors (10 ug/mL aprotinin, 10 ug/mL leupeptin, 1mM sodium orthovanadate and 100 ug/mL phenylmethylsulfonyl chloride). After cell lysis by sonification, cell debris was removed by centrifugation (13,000 g, 20 min, 4 degree C). Protein concentration was determined using a Pierce bicinchoninic acid (BCA) protein assay and spectroscopy at 540 nm. Cell lysate was snap frozen in liquid nitrogen and stored at -80 degree c.40 ug of each protein were loaded into seperate lanes of a 10% sodium dodecylsulphate (SDS)-polyacrylamide gel and electrophoresed using Bio-Rad equipment, then electrophoretically transfered onto PVDF membrane.  Bio-Rad Precision Plus Protein Kaleidoscope (Cat#161-0375) was routinely used as a protein size marker. To inhibit non-specific binding, membranes were first soaked in a blocking solution of 5 % skim milk in Tris-buffered saline (TBS) with Tween-20 pH 7.4 (TBST) (5% blotto) for 1 hour. Membrane were blotted with the primary antibody provided. Primary antibodies were diluted in a 1% blotto solution and incubated for 18-24 h at 4 degree C. Membranes were washed X3 in TBST for 5 min. Goat anti-rabbit IgG-HRP-conjugated secondary antibody diluted at 1:2000 in 1% blotto was used for 1h at RT. Protein bands were visualised using enhanced chemiluminescence and X-ray flim. Developed flims were scanned using a Canon Canoscan 8400F at 300dpi.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...