Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CHI3L1 antibody - middle region (ARP51929_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP51929_P050-FITC Conjugated

ARP51929_P050-HRP Conjugated

ARP51929_P050-Biotin Conjugated

Gene Symbol:
CHI3L1
NCBI Gene Id:
1116
Official Gene Full Name:
Chitinase 3-like 1 (cartilage glycoprotein-39)
Protein Name:
Chitinase-3-like protein 1
Swissprot Id:
P36222
Protein Accession #:
NP_001267
Nucleotide Accession #:
NM_001276
Alias Symbols:
DKFZp686N19119, FLJ38139, GP39, HC-gp39, HCGP-3P, YKL40, YYL-40, ASRT7, GP-39, CGP-39, YKL-40, hCGP-39
Replacement Item:
This antibody may replace item sc-110933 from Santa Cruz Biotechnology.
Description of Target:
CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Protein Size (# AA):
383
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHI3L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHI3L1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1
Species Reactivity:
Cow, Dog, Goat, Human, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 77%; Goat: 92%; Human: 100%; Pig: 92%; Rabbit: 100%; Rat: 77%
Complete computational species homology data:
Anti-CHI3L1 (ARP51929_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CHI3L1;
Blocking Peptide:
For anti-CHI3L1 (ARP51929_P050) antibody is Catalog # AAP51929 (Previous Catalog # AAPP30195)
Datasheets/Manuals:
Printable datasheet for anti-CHI3L1 (ARP51929_P050) antibody
Target Reference:
Ober,C., (2008) N. Engl. J. Med. 358 (16), 1682-1691
Publications:

Kao, T.-H., Peng, Y.-J., Tsou, H.-K., Salter, D. M. & Lee, H.-S. Nerve growth factor promotes expression of novel genes in intervertebral disc cells that regulate tissue degradation. J. Neurosurg. Spine 1-9 (2014). doi:10.3171/2014.6.SPINE13756 IF, WB, Cow, Dog, Goat, Human, Pig, Rabbit, Rat 25062286

Tell us what you think about this item!

Write A Review
    Please, wait...