Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CETP antibody - middle region (ARP51760_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP51760_P050-FITC Conjugated

ARP51760_P050-HRP Conjugated

ARP51760_P050-Biotin Conjugated

Gene Symbol:
CETP
NCBI Gene Id:
1071
Official Gene Full Name:
Cholesteryl ester transfer protein, plasma
Protein Name:
Cholesteryl ester transfer protein
Swissprot Id:
P11597
Protein Accession #:
NP_000069
Nucleotide Accession #:
NM_000078
Alias Symbols:
BPIFF, HDLCQ10
Replacement Item:
This antibody may replace item sc-25833 from Santa Cruz Biotechnology.
Description of Target:
CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia. Cholesteryl ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
493
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CETP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CETP.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CETP
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-CETP (ARP51760_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRKACG; ARPC3; APOA1; LPL; EWSR1; CETP;
Blocking Peptide:
For anti-CETP (ARP51760_P050) antibody is Catalog # AAP51760 (Previous Catalog # AAPP40135)
Datasheets/Manuals:
Printable datasheet for anti-CETP (ARP51760_P050) antibody
Target Reference:
Srivastava,N., Mol. Cell. Biochem. 314 (1-2), 171-177 (2008)

Tell us what you think about this item!

Write A Review
    Please, wait...