Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CENPN antibody - middle region (ARP57258_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP57258_P050-FITC Conjugated

ARP57258_P050-HRP Conjugated

ARP57258_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Centromere protein N
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BM039, C16orf60, CENP-N, FLJ13607, FLJ22660
Replacement Item:
This antibody may replace item sc-69152 from Santa Cruz Biotechnology.
Description of Target:
The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CENPN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CENPN.
The immunogen is a synthetic peptide directed towards the middle region of human CENPN
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 79%
Complete computational species homology data:
Anti-CENPN (ARP57258_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CENPN (ARP57258_P050) antibody is Catalog # AAP57258 (Previous Catalog # AAPP44233)
Datasheets / Downloads:
Printable datasheet for anti-CENPN (ARP57258_P050) antibody
Sample Type Confirmation:

CENPN is supported by BioGPS gene expression data to be expressed in Jurkat

Customer Reviews for CENPN Antibody (ARP57258_P050) tested with DNA/ACA in Immunofluorescence

Validation Type:

We tested these antibodies for immunofluorescence using both formaldehyde fixation and methanol fixation. We also tried pre-extraction with detergent for the antibodies.

For the CENP antibodies, these should localize to the centromere. To test this localization, we co-localized these antibodies with ACA (anti-centromere antibodies). The CENP-M antibody (and to a lesser extent CENP-I) did show some punctate foci that co-localized with the ACA.

The CENP-N antibodies showed punctate foci, but these did not appear to co-localize with ACA suggesting that they are background.

-Iain Cheeseman

Product Protocols: CENPN antibody tested with Human Jurkat Cells (ARP57258_P050)

Aviva Systems Biology is the original manufacturer of this CENPN antibody (ARP57258_P050)

Click here to view the CENPN antibody Western Blot Protocol

Product Datasheet Link: CENPN antibody (ARP57258_P050)

WB Suggested Anti-CENPN Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CENPN antibody (ARP57258_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

CENPN Antibody (ARP57258_P050) tested with HeLa by Immunofluorescence

CENPN antibody - middle region (ARP57258_P050)

Cell Seeding

-Allow cells to attach for 24 hours at 37 °C and 5% CO2

Fix, Wash, Block
-Fix cells using 4% PFA for 30 mins
-Wash 3x with permeabilizing wash buffer (PBS+0.3% Tx-100)
-Block with 5% goat serum, 1% BSA, and 0.2% fish gelatin
-Incubate at 4 °C overnight

Primary Addition
-Remove block solution
-Add primary antibody diluted 1:250
-Incubate at 4 °C overnight

Secondary Addition
-Wash cells 3x with PBS
-Add secondary solution (Hoechst 1:1000 + AlexaFluor 568 anti-Rabbit 1:500 in PBS)
-Incubate at room temperature for 2 hours

-Image collecting 2 channels (Hoechst excitation= 360+20nm, emmission= 460+25nm; BLUE) and (AlexaFluor 568 excitation= 535+25nm, emmision= 620+30nm; GREEN)
-Exposure time: 200ms

CENPN Antibody (ARP57258_P050) tested with Huh-7 by Immunofluorescence

CENPN antibody - middle region (ARP57258_P050)

Cell Seeding

-Allow cells to attach for 24 hours at 37 °C and 5% CO2

Fix, Wash, Block
-Fix cells using 4% PFA for 30 mins
-Wash 3x with permeabilizing wash buffer (PBS+0.3% Tx-100)
-Block with 5% goat serum, 1% BSA, and 0.2% fish gelatin
-Incubate at 4 °C overnight

Primary Addition
-Remove block solution
-Add primary antibody diluted 1:250
-Incubate at 4 °C overnight

Secondary Addition
-Wash cells 3x with PBS
-Add secondary solution (Hoechst 1:1000 + AlexaFluor 568 anti-Rabbit 1:500 in PBS)
-Incubate at room temperature for 2 hours

-Image collecting 2 channels (Hoechst excitation= 360+20nm, emmission= 460+25nm; BLUE) and (AlexaFluor 568 excitation= 535+25nm, emmision= 620+30nm; GREEN)
-Exposure time: 200ms

CENPN Antibody (ARP57258_P050) tested with MCF7 by Immunofluorescence

CENPN antibody - middle region (ARP57258_P050)

Cell Seeding

-Allow cells to attach for 24 hours at 37 °C and 5% CO2

Fix, Wash, Block
-Fix cells using 4% PFA for 30 mins
-Wash 3x with permeabilizing wash buffer (PBS+0.3% Tx-100)
-Block with 5% goat serum, 1% BSA, and 0.2% fish gelatin
-Incubate at 4 °C overnight

Primary Addition
-Remove block solution
-Add primary antibody diluted 1:250
-Incubate at 4 °C overnight

Secondary Addition
-Wash cells 3x with PBS
-Add secondary solution (Hoechst 1:1000 + AlexaFluor 568 anti-Rabbit 1:500 in PBS)
-Incubate at room temperature for 2 hours

-Image collecting 2 channels (Hoechst excitation= 360+20nm, emmission= 460+25nm; BLUE) and (AlexaFluor 568 excitation= 535+25nm, emmision= 620+30nm; GREEN)
-Exposure time: 200ms

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...