Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CENPN antibody - middle region (ARP57258_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP57258_P050-FITC Conjugated

ARP57258_P050-HRP Conjugated

ARP57258_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Centromere protein N
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BM039, C16orf60, CENP-N, FLJ13607, FLJ22660
Replacement Item:
This antibody may replace item sc-69152 from Santa Cruz Biotechnology.
Description of Target:
The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CENPN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CENPN.
The immunogen is a synthetic peptide directed towards the middle region of human CENPN
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 79%
Complete computational species homology data:
Anti-CENPN (ARP57258_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CENPN (ARP57258_P050) antibody is Catalog # AAP57258 (Previous Catalog # AAPP44233)
Printable datasheet for anti-CENPN (ARP57258_P050) antibody
Sample Type Confirmation:

CENPN is supported by BioGPS gene expression data to be expressed in Jurkat

Tell us what you think about this item!

Write A Review
    Please, wait...