Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CENPI antibody - N-terminal region (ARP54805_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP54805_P050-FITC Conjugated

ARP54805_P050-HRP Conjugated

ARP54805_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CENPI
NCBI Gene Id:
2491
Official Gene Full Name:
Centromere protein I
Protein Name:
Centromere protein I
Swissprot Id:
Q92674
Protein Accession #:
NP_006724
Nucleotide Accession #:
NM_006733
Alias Symbols:
CENP-I, FSHPRH1, LRPR1, Mis6
Description of Target:
CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.
Protein Size (# AA):
756
Molecular Weight:
87kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CENPI.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CENPI.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-CENPI (ARP54805_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CENPU; CENPM; CENPN; APP; CENPP; CENPO; CENPH; SUMO2; UBC; CENPA;
Blocking Peptide:
For anti-CENPI (ARP54805_P050) antibody is Catalog # AAP54805 (Previous Catalog # AAPP31609)
Datasheets/Manuals:
Printable datasheet for anti-CENPI (ARP54805_P050) antibody
Sample Type Confirmation:

CENPI is strongly supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Izuta,H., (2006) Genes Cells 11 (6), 673-684

Tell us what you think about this item!

Write A Review
    Please, wait...