Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CDH1 antibody - middle region (ARP59265_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP59265_P050-FITC Conjugated

ARP59265_P050-HRP Conjugated

ARP59265_P050-Biotin Conjugated

Gene Symbol:
CDH1
NCBI Gene Id:
999
Official Gene Full Name:
Cadherin 1, type 1, E-cadherin (epithelial)
Protein Name:
Cadherin-1
Swissprot Id:
P12830
Protein Accession #:
NP_004351
Nucleotide Accession #:
NM_004360
Alias Symbols:
Arc-1, CD324, CDHE, ECAD, LCAM, UVO
Replacement Item:
This antibody may replace item sc-1499 from Santa Cruz Biotechnology.
Description of Target:
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7.
Protein Size (# AA):
882
Molecular Weight:
80kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CDH1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 92%; Zebrafish: 93%
Complete computational species homology data:
ARP59265_P050
Peptide Sequence:
Synthetic peptide located within the following region: FSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MDM2; UCHL3; CDC27; PTEN; CTNNB1; PIP5K1C; CTNND1; CBLL1; RNF2; GMNN; LMNA; KRT18; KRT9; KRT8; KRT1; IGHA1; HSPD1; HSP90AA1; HSPA9; HSPA8; HSPA5; GBAS; CTNNA1; CRYAB; CFTR; C1QBP; ACTN4; ACADVL; ANP32B; NIPSNAP1; XRCC5; TGM2; SKP2; SET; RAD17; POLR2E
Blocking Peptide:
Catalog # AAP59265 (Previous Catalog # AAPP45252)
Datasheets/Manuals:
Printable datasheet for ARP59265_P050

Tell us what you think about this item!

Write A Review
    Please, wait...