Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CDC42 antibody - N-terminal region : FITC (AVARP01017_P050-FITC)

100 ul
$289.00
In Stock

Conjugation Options

AVARP01017_P050 Unconjugated

AVARP01017_P050-HRP Conjugated

AVARP01017_P050-Biotin Conjugated

Gene Symbol:
CDC42
NCBI Gene Id:
998
Official Gene Full Name:
Cell division cycle 42 (GTP binding protein, 25kDa)
Protein Name:
Cell division control protein 42 homolog
Swissprot Id:
P60953
Protein Accession #:
NP_001782
Nucleotide Accession #:
NM_001791
Alias Symbols:
CDC42Hs, G25K
Replacement Item:
This antibody may replace item sc-34314 from Santa Cruz Biotechnology.
Description of Target:
CDC42 is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants.The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants.
Protein Size (# AA):
191
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CDC42.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CDC42.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42
Species Reactivity:
Dog, Rabbit
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rabbit: 100%
Peptide Sequence:
Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
PARD6B; CDC42EP1; CDC42EP2; PAK2; UBC; TRAF2; PAK1; ARHGDIA; BIRC2; TNK2; TCEB2; EPRS; LARS; RUVBL1; NEK6; WIPF1; WASL; RIOK3; SSX2IP; DIAPH3; BAIAP2; PAK3; ZNF420; IQGAP1; RAP1A; WAS; TGFBR2; TGFBR1; ARHGEF6; LRRK2; FGD3; ARHGAP1; SH3RF3; BCAR1; USP6; EL
Blocking Peptide:
For anti-CDC42 (AVARP01017_P050-FITC) antibody is Catalog # AAP30406 (Previous Catalog # AAPP00929)
Datasheets/Manuals:
Printable datasheet for anti-CDC42 (AVARP01017_P050-FITC) antibody
Sample Type Confirmation:

CDC42 is supported by BioGPS gene expression data to be expressed in 721_B

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Black,S.A. (2008) J. Biol. Chem. 283 (16), 10835-10847

Tell us what you think about this item!

Write A Review
    Please, wait...