Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Ccna2 antibody - C-terminal region (ARP30159_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP30159_P050-FITC Conjugated

ARP30159_P050-HRP Conjugated

ARP30159_P050-Biotin Conjugated

Gene Symbol:
Ccna2
NCBI Gene Id:
114494
Official Gene Full Name:
Cyclin A2
Protein Accession #:
NP_446154
Nucleotide Accession #:
NM_053702
Alias Symbols:
MGC156527, Ccna2
Replacement Item:
This antibody may replace item sc-136253 from Santa Cruz Biotechnology.
Description of Target:
The function of Ccna2 remains unknown.
Protein Size (# AA):
418
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ccna2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ccna2.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Rat
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 82%; Zebrafish: 77%
Complete computational species homology data:
Anti-Ccna2 (ARP30159_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ccna2 (ARP30159_P050) antibody is Catalog # AAP30159 (Previous Catalog # AAPS08605)
Datasheets/Manuals:
Printable datasheet for anti-Ccna2 (ARP30159_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...