Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CBS antibody - N-terminal region (ARP45746_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP45746_T100-FITC Conjugated

ARP45746_T100-HRP Conjugated

ARP45746_T100-Biotin Conjugated

Gene Symbol:
CBS
NCBI Gene Id:
875
Official Gene Full Name:
Cystathionine-beta-synthase
Protein Name:
Cystathionine beta-synthase
Swissprot Id:
P35520
Protein Accession #:
NP_000062
Nucleotide Accession #:
NM_000071
Alias Symbols:
HIP4
Replacement Item:
This antibody may replace item sc-111129 from Santa Cruz Biotechnology.
Description of Target:
CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.
Protein Size (# AA):
551
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBS.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CBS
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 93%
Complete computational species homology data:
Anti-CBS (ARP45746_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBASH3A; UBE2I; PSMA1; PRKAG1; PIN1; EHHADH; CBS; SUMO1; UBC; NEDD8; PIAS3; RANBP9; PIAS1; CBX4; SRP14; RAD23B; PKM; NUCB1; IREB2; HSF1; LRSAM1; C14orf142; UBA5; IPO4; GOPC; PARP6; NPLOC4; DERA; ERO1L; DBNL; GPN1; PDLIM5; PLIN3; UBA2; GPSM1; COL4A3BP; UGP
Blocking Peptide:
For anti-CBS (ARP45746_T100) antibody is Catalog # AAP45746 (Previous Catalog # AAPP26703)
Datasheets/Manuals:
Printable datasheet for anti-CBS (ARP45746_T100) antibody
Additional Information:
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Urreizti,R., (2006) J. Hum. Genet. 51 (4), 305-313
Publications:

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23063804

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23103828

Markand, S. et al. Cystathionine beta synthase expression in mouse retina. Curr. Eye Res. 38, 597-604 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23470016

Dahlhoff, C. et al. Hepatic methionine homeostasis is conserved in C57BL/6N mice on high-fat diet despite major changes in hepatic one-carbon metabolism. PLoS One 8, e57387 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23472083

Porteus, C. S. et al. The role of hydrogen sulphide in the control of breathing in hypoxic zebrafish (Danio rerio). J. Physiol. 592, 3075-88 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24756639

Geillinger, K. E. et al. Hepatic metabolite profiles in mice with a suboptimal selenium status. J. Nutr. Biochem. 25, 914-22 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24917045

Yamane, S., Kanno, T., Nakamura, H., Fujino, H. & Murayama, T. Hydrogen sulfide-mediated regulation of contractility in the mouse ileum with electrical stimulation: Roles of l-cysteine, cystathionine β-synthase, and K(+) channels. Eur. J. Pharmacol. 740, 112-20 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25008073

Dahlhoff, C. et al. Methyl-donor supplementation in obese mice prevents the progression of NAFLD, activates AMPK and decreases acyl-carnitine levels. Mol. Metab. 3, 565-80 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25061561

Tell us what you think about this item!

Write A Review
    Please, wait...