Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CAT antibody - middle region (ARP58437_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP58437_P050-FITC Conjugated

ARP58437_P050-HRP Conjugated

ARP58437_P050-Biotin Conjugated

Gene Symbol:
CAT
NCBI Gene Id:
847
Official Gene Full Name:
Catalase
Protein Name:
Catalase
Swissprot Id:
P04040
Protein Accession #:
NP_001743
Nucleotide Accession #:
NM_053052
Alias Symbols:
MGC138422, MGC138424
Replacement Item:
This antibody may replace item sc-34280 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide t
Protein Size (# AA):
527
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CAT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CAT.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CAT
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 93%
Complete computational species homology data:
Anti-CAT (ARP58437_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; KEAP1; PEX5; EHHADH; CAT; STIM1; HSD17B4; APP; MECP2; SUMO4; USP53; TLR10; PTPN11; ABL2; ABL1;
Blocking Peptide:
For anti-CAT (ARP58437_P050) antibody is Catalog # AAP58437 (Previous Catalog # AAPP34517)
Datasheets/Manuals:
Printable datasheet for anti-CAT (ARP58437_P050) antibody
Target Reference:
Holt,M., (2006) J. Biol. Chem. 281 (25), 17076-17083

Tell us what you think about this item!

Write A Review
    Please, wait...