Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CASP3 antibody - C-terminal region (ARP58987_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP58987_P050-FITC Conjugated

ARP58987_P050-HRP Conjugated

ARP58987_P050-Biotin Conjugated

Gene Symbol:
CASP3
NCBI Gene Id:
836
Official Gene Full Name:
Caspase 3, apoptosis-related cysteine peptidase
Protein Name:
Caspase-3
Swissprot Id:
P42574
Protein Accession #:
NP_116786
Nucleotide Accession #:
NM_032991
Alias Symbols:
CPP32, CPP32B, SCA-1
Replacement Item:
This antibody may replace item sc-113427 from Santa Cruz Biotechnology.
Description of Target:
CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.
Protein Size (# AA):
277
Molecular Weight:
12kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IF, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CASP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CASP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CASP3
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 91%; Dog: 93%; Goat: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%
Complete computational species homology data:
Anti-CASP3 (ARP58987_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAX; PARP1; PTGES3; XIAP; CRYAB; BIRC7; UBC; MDM2; Gzmb; VIM; STAT1; SPTAN1; ROCK1; GSN; DFFA; CASP9; CASP7; CASP6; CASP2; BID; ARHGDIA; TNFSF10; PLA2G4B; CDKN1A; RB1; PRKDC; GLRX; GATA1; SOCS5; YWHAG; MAPK9; MAPK8; SP1; PKN1; CASP8; BIRC3; BIRC2; ZBTB16;
Blocking Peptide:
For anti-CASP3 (ARP58987_P050) antibody is Catalog # AAP58987 (Previous Catalog # AAPP44954)
Datasheets/Manuals:
Printable datasheet for anti-CASP3 (ARP58987_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...