website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

C/EBP-beta Antibody (Phospho-Thr235/188) (OAAF07327)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ug
$289.00
In Stock

Conjugation Options

OAAF07327-FITC Conjugated

OAAF07327-HRP Conjugated

OAAF07327-Biotin Conjugated

Gene Symbol:
CEBPB
NCBI Gene Id:
1051
Swissprot Id:
P17676
Alias Symbols:
AGP/EBP, C/EBP beta, C/EBP-related protein 2, CCAAT/enhancer binding protein beta, CEBPB, CRP2, IL-6DBP, Interleukin-6- dependent binding protein, LAP, Liver-enriched transcriptional activator, Nuclear factor NF-IL6, SF-B, SFB, Silencer facto
Replacement Item:
This antibody may replace item sc-150 from Santa Cruz Biotechnology.
Molecular Weight:
36 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Application:
WB, IHC, IF, ELISA
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CEBPB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CEBPB.
Immunogen:
The antiserum was produced against synthesized peptide derived from human C/EBP-beta around the phosphorylation site of Thr235/188.
Species Reactivity:
Human, Mouse, Rat
Peptide Sequence:
Synthetic peptide located within the following region: AGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYA
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Concentration:
1mg/ml
Datasheets / Downloads:
OAAF07327
Specificity:
C/EBP-beta (Phospho-Thr235/188) Antibody detects endogenous levels of C/EBP-beta only when phosphorylated at Thr235/188.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:10000
Additional Information:
Modification Sites: Human:T235 Mouse:T188 Rat:T189
Protocol:
Tips Information:
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...