Now Offering Over 102,157 Antibodies & 44,722 Antigens!

BRCA1 antibody - middle region (ARP33338_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP33338_P050-FITC Conjugated

ARP33338_P050-HRP Conjugated

ARP33338_P050-Biotin Conjugated

Gene Symbol:
BRCA1
NCBI Gene Id:
672
Official Gene Full Name:
Breast cancer 1, early onset
Protein Name:
Breast cancer type 1 susceptibility protein
Swissprot Id:
P38398
Protein Accession #:
NP_009225
Nucleotide Accession #:
NM_007294
Alias Symbols:
BRCAI, BRCC1, IRIS, PSCP, RNF53, PNCA4, BROVCA1, PPP1R53
Replacement Item:
This antibody may replace item sc-1021 from Santa Cruz Biotechnology.
Description of Target:
The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation.This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability and acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as BASC for BRCA1-associated genome surveillance complex. This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complex. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants have been described for this gene but only some have had their full-length natures identified.
Protein Size (# AA):
1863
Molecular Weight:
208kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BRCA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BRCA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human BRCA1
Species Reactivity:
Cow, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 75%; Human: 100%; Mouse: 79%; Rat: 86%
Complete computational species homology data:
Anti-BRCA1 (ARP33338_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RAD50; MED17; RAD51; YAP3; HDA3; SSN3; BEM4; GYP5; YAF9; HDAC2; MSH6; BAP1; SUPT5H; POLR2A; NPR1; NUP53; MET18; CDC21; MLP1; CTK1; MSH2; BACH1; DAN1; TMA22; BBC1; RPB4; SPT4; YGR053C; ATE1; YBP2; SLI15; RAD16; XRS2; RAD55; BUR2; BRIP1; ESR1; BECN1; HIST1H
Blocking Peptide:
For anti-BRCA1 (ARP33338_P050) antibody is Catalog # AAP33338 (Previous Catalog # AAPP04380)
Datasheets/Manuals:
Printable datasheet for anti-BRCA1 (ARP33338_P050) antibody
Target Reference:
Evans,D.G., (er) BMC Cancer 8 (1), 155 (2008) In press

Tell us what you think about this item!

Write A Review
    Please, wait...