Aviva Systems Biology office will be closed for Memorial Holiday - May 28th, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

BCL2L1 antibody - N-terminal region (ARP30475_T100)

Scroll Horizontally to view all Images

 

Print Page
100 ul
$229.00
In Stock

Conjugation Options

ARP30475_T100-FITC Conjugated

ARP30475_T100-HRP Conjugated

ARP30475_T100-Biotin Conjugated

Gene Symbol:
BCL2L1
NCBI Gene Id:
598
Official Gene Full Name:
BCL2-like 1
Protein Name:
Bcl-2-like protein 1
Swissprot Id:
Q07817
Protein Accession #:
NP_612815
Nucleotide Accession #:
NM_138578
Alias Symbols:
BCL-XL/S, BCL2L, BCLX, Bcl-X, DKFZp781P2092, bcl-xL, bcl-xS, BCLXL, BCLXS, PPP1R52
Replacement Item:
This antibody may replace item sc-1041 from Santa Cruz Biotechnology.
Description of Target:
BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis.The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.
Protein Size (# AA):
233
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BCL2L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BCL2L1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BCL2L1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Complete computational species homology data:
Anti-BCL2L1 (ARP30475_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAING
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BCL2L1; BCL2; BAX; BAD; BMF; BBC3; CASP8AP2; BECN1; UBC; TPT1; TP53BP2; ced-9; ced-4; PGAM5; CDKN2A; CASP1; BCL2L11; HRK; PMAIP1; BIK; BID; PARK2; PINK1; BAK1; RAD9A; AKT1; Mapk1; ATXN3; CLU; BCAP31; CRYAB; CRYAA; BFAR; PPP1CC; PPP1CA; ACTB; UBR1; METTL23
Blocking Peptide:
For anti-BCL2L1 (ARP30475_T100) antibody is Catalog # AAP30475 (Previous Catalog # AAPP24055)
Datasheets/Manuals:
Printable datasheet for anti-BCL2L1 (ARP30475_T100) antibody
Sample Type Confirmation:

BCL2L1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Allikmets,R., (2006) J. Mol. Biol. 356 (2), 367-381

Product Protocols: BCL2L1 antibody tested with Human Hepg2 Cells (ARP30475_T100)

Aviva Systems Biology is the original manufacturer of this BCL2L1 antibody (ARP30475_T100)

Click here to view the BCL2L1 antibody Western Blot Protocol

Product Datasheet Link: BCL2L1 antibody (ARP30475_T100)

WB Suggested Anti-BCL2L1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis.The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s BCL2L1 antibody (ARP30475_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...